PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009778768.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 67aa    MW: 7559.91 Da    PI: 10.5468
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009778768.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF801.6e-25957149
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    krie+ks rqvt++kRr+g++KKA+ LS+LCd++vav++fs +g+lye 
  XP_009778768.1  9 KRIEEKSSRQVTLCKRRKGLIKKAKQLSILCDVDVAVVVFSDRGTLYES 57
                    79*********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006627.712161IPR002100Transcription factor, MADS-box
SMARTSM004324.4E-32160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-25161IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-23323IPR002100Transcription factor, MADS-box
PfamPF003192.4E-231056IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-233859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 67 aa     Download sequence    Send to blast
MGRKKVEMKR IEEKSSRQVT LCKRRKGLIK KAKQLSILCD VDVAVVVFSD RGTLYESSTP  60
SRDVSCA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S5e-15163163Myocyte-specific enhancer factor 2B
1tqe_R5e-15163163Myocyte-specific enhancer factor 2B
1tqe_Q5e-15163163Myocyte-specific enhancer factor 2B
1tqe_P5e-15163163Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009778768.14e-41PREDICTED: MADS-box transcription factor 21-like isoform X1
SwissprotQ6R4R96e-22CALA_BRAOB; Truncated transcription factor CAULIFLOWER A
TrEMBLQ6UGR21e-27Q6UGR2_PETHY; MADS-box protein 17 (Fragment)
STRINGSolyc05g015730.1.18e-26(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.31e-23MIKC_MADS family protein